PDB entry 3aba

View 3aba on RCSB PDB site
Description: Crystal structure of CYP105P1 in complex with filipin I
Class: oxidoreductase/antibiotic
Keywords: P450, oxidoreductase, heme, monooxygenase, macrolide, filipin, Iron, Metal-binding, OXIDOREDUCTASE-ANTIBIOTIC complex
Deposited on 2009-12-04, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Streptomyces avermitilis [TaxId:33903]
    Gene: pteC, SAV413, SAV_413
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93H81 (Start-398)
      • expression tag (399-402)
    Domains in SCOPe 2.07: d3abaa1, d3abaa2
  • Heterogens: HEM, FLI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3abaA (A:)
    mpeptadaptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrd
    ssfsvqvphalhtqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqr
    ivdehldaiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaa
    ateaagmrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahd
    ttacmiglgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelgg
    vriakgeqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqi
    vfetlfrrlpglrlakpveelrfrhdmvfygvhelpvtwhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3abaA (A:)
    daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq
    vphalhtqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehl
    daiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaag
    mrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmi
    glgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakg
    eqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlf
    rrlpglrlakpveelrfrhdmvfygvhelpvtwhhhh