PDB entry 3ab6

View 3ab6 on RCSB PDB site
Description: crystal structure of nag3 bound lysozyme from meretrix lusoria
Deposited on 2009-12-01, released 2010-12-01
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Meretrix lusoria [TaxId:74491]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ab6A (A:)
faggtvsqrclscickmesgcrnvgckmdmgslscgyfqikeaywidcgrpgsswkscaa
ssycaslcvqnymkryakwagcplrcegfarehnggprgckkgstigywnrlqkisgchg
vq