PDB entry 3ab3

View 3ab3 on RCSB PDB site
Description: Crystal structure of p115RhoGEF RGS domain in complex with G alpha 13
Class: signaling protein/membrane protein
Keywords: SIGNAL TRANSDUCTION, PROTEIN COMPLEX, GTP-BINDING, MEMBRANE, TRANSDUCER, Lipoprotein, Nucleotide-binding, Palmitate, Phosphoprotein, GTPase activation, Guanine-nucleotide releasing factor, SIGNALING PROTEIN-MEMBRANE PROTEIN complex
Deposited on 2009-11-30, released 2010-12-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(k) subunit alpha, Guanine nucleotide-binding protein subunit alpha-13
    Species: Mus musculus [TaxId:10090]
    Gene: Gna13, Gna-13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ab3a1, d3ab3a2
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ab3b_
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(k) subunit alpha, Guanine nucleotide-binding protein subunit alpha-13
    Species: Mus musculus [TaxId:10090]
    Gene: Gna13, Gna-13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ab3c1, d3ab3c2
  • Chain 'D':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GDP, ALF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ab3A (A:)
    mgctlsaedkaaverskmidrnlredgersarlvkilllgagesgkstflkqmriihgqd
    fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
    mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
    illarrptkgiheydfeiknvpfkmvdvggqrserkrwfecfdsvtsilflvsssefdqv
    lmedrqtnrlteslnifetivnnrvfsnvsiilflnktdlleekvqvvsikdyflefegd
    phclrdvqkflvecfrgkrrdqqqrplyhhfttaintenirlvfrdvkdtilhdnlkqlm
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ab3A (A:)
    rlvkilllgagesgkstflkqmriihgqdfdqrareefrptiysnvikgmrvlvdarekl
    hipwgdnknqlhgdklmafdtrapmaaqgmvetrvflqylpairalwedsgiqnaydrrr
    efqlgesvkyfldnldklgvpdyipsqqdillarrptkgiheydfeiknvpfkmvdvggq
    rserkrwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsi
    ilflnktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdplyhhfttai
    ntenirlvfrdvkdtilhdnlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ab3B (B:)
    gamgiqcggilvpmedfargaaspgpsrpglvpvsiigaededfeneletnseeqnsqfq
    sleqvkrrpahlmallqhvalqfepgpllcclhadmlgslgpkeakkafldfyhsflekt
    avlrvpvppnvafeldrtradlisedvqrrfvqevvqsqqvavgrqledfrskrlmgmtp
    weqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaiglymr
    hlgvrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ab3B (B:)
    siigaededfenefqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgkkafldf
    yhsflektavlrvpvppnvafevqrrfvqevvqsqqvavgrqledfrskrlmgmtpweqe
    laqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaiglymrhlgv
    rt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ab3C (C:)
    mgctlsaedkaaverskmidrnlredgersarlvkilllgagesgkstflkqmriihgqd
    fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
    mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
    illarrptkgiheydfeiknvpfkmvdvggqrserkrwfecfdsvtsilflvsssefdqv
    lmedrqtnrlteslnifetivnnrvfsnvsiilflnktdlleekvqvvsikdyflefegd
    phclrdvqkflvecfrgkrrdqqqrplyhhfttaintenirlvfrdvkdtilhdnlkqlm
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ab3C (C:)
    rlvkilllgagesgkstflkqmriihgqdfdqrareefrptiysnvikgmrvlvdarekl
    hipwgdnknqlhgdklmafdtrapmaaqgmvetrvflqylpairalwedsgiqnaydrrr
    efqlgesvkyfldnldklgvpdyipsqqdillarrptkgiheydfeiknvpfkmvdvggq
    rserkrwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsi
    ilflnktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdplyhhfttai
    ntenirlvfrdvkdtilh
    

  • Chain 'D':
    No sequence available.