PDB entry 3aas

View 3aas on RCSB PDB site
Description: Bovine beta-trypsin bound to meta-guanidino schiff base copper (II) chelate
Class: hydrolase
Keywords: enzyme-inhibitor complex, coordination metal based inhibitor, hydrolase, Calcium, Digestion, Metal-binding, Protease, Secreted, Serine protease, Zymogen
Deposited on 2009-11-26, released 2010-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3aasa_
  • Heterogens: GUS, CA, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aasA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn