PDB entry 3aac

View 3aac on RCSB PDB site
Description: Small heat shock protein hsp14.0 with the mutations of I120F and I122F in the form II crystal
Class: chaperone
Keywords: alpha-crystallin domain, CHAPERONE
Deposited on 2009-11-13, released 2010-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein ST1653
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q970D9 (0-122)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d3aaca_
  • Chain 'B':
    Compound: Putative uncharacterized protein ST1653
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q970D9 (Start-122)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d3aacb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aacA (A:)
    myylgkelqkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqnel
    iieaereitepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvf
    kfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aacB (B:)
    myylgkelqkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqnel
    iieaereitepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvf
    kfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aacB (B:)
    ylgkelqkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqnelii
    eaereitepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvfkf
    e