PDB entry 3aa3

View 3aa3 on RCSB PDB site
Description: A52L E. coli RNase HI
Class: Hydrolase
Keywords: stability, cavity, Endonuclease, Hydrolase, Magnesium, Metal-binding, Nuclease
Deposited on 2009-11-11, released 2010-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease hi
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7Y4 (0-154)
    • engineered mutation (51)
  Domains in SCOPe 2.08: d3aa3a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3aa3A (A:)
  mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmalivalealk
  ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
  vkghaghpenercdelaraaamnptledtgyqvev