PDB entry 3a9t

View 3a9t on RCSB PDB site
Description: X-ray Structure of Bacillus pallidus D-Arabinose Isomerase Complex with L-Fucitol
Class: isomerase
Keywords: Rossmann fold, bete barrel, Carbohydrate metabolism, Cytoplasm, Fucose metabolism, Isomerase, Manganese, Metal-binding
Deposited on 2009-11-05, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.161
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-arabinose isomerase
    Species: Geobacillus pallidus [TaxId:33936]
    Gene: dai
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SSE7
      • engineered (224)
      • engineered (588-589)
    Domains in SCOPe 2.07: d3a9ta1, d3a9ta2
  • Chain 'B':
    Compound: D-arabinose isomerase
    Species: Geobacillus pallidus [TaxId:33936]
    Gene: dai
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SSE7
      • engineered (224)
      • engineered (588-589)
    Domains in SCOPe 2.07: d3a9tb1, d3a9tb2
  • Chain 'C':
    Compound: D-arabinose isomerase
    Species: Geobacillus pallidus [TaxId:33936]
    Gene: dai
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SSE7
      • engineered (224)
      • engineered (588-589)
    Domains in SCOPe 2.07: d3a9tc1, d3a9tc2
  • Heterogens: FOC, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a9tA (A:)
    makdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvec
    viadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngter
    pgavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgk
    sylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvk
    enckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnai
    vagfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt
    aqifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpy
    yeltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqia
    egytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghi
    gadlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackklgpiyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9tA (A:)
    akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv
    iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp
    gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks
    ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke
    nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv
    agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnta
    qifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpyy
    eltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqiae
    gytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghig
    adlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a9tB (B:)
    makdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvec
    viadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngter
    pgavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgk
    sylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvk
    enckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnai
    vagfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt
    aqifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpy
    yeltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqia
    egytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghi
    gadlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackklgpiyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9tB (B:)
    akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv
    iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp
    gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks
    ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke
    nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv
    agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnta
    qifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpyy
    eltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqiae
    gytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghig
    adlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a9tC (C:)
    makdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvec
    viadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngter
    pgavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgk
    sylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvk
    enckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnai
    vagfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt
    aqifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpy
    yeltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqia
    egytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghi
    gadlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackklgpiyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9tC (C:)
    akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv
    iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp
    gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks
    ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke
    nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv
    agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnta
    qifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpyy
    eltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqiae
    gytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghig
    adlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackkl