SCOPe 2.08: Structural Classification of Proteins

PDB entry 3a9q

View 3a9q on RCSB PDB site
Description: Crystal Structure Analysis of E173A variant of the soybean ferritin SFER4
Class: oxidoreductase
Keywords: 4-helix bundle, Chloroplast, Iron, Iron storage, Metal-binding, Oxidoreductase, Plastid, Transit peptide
Deposited on 2009-11-05, released 2009-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.152
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qa_
Chain 'B':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qb_
Chain 'C':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qc_
Chain 'D':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qd_
Chain 'E':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qe_
Chain 'F':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qf_
Chain 'G':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qg_
Chain 'H':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qh_
Chain 'I':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qi_
Chain 'J':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qj_
Chain 'K':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qk_
Chain 'L':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9ql_
Chain 'M':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qm_
Chain 'N':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qn_
Chain 'O':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qo_
Chain 'P':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qp_
Chain 'Q':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qq_
Chain 'R':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qr_
Chain 'S':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qs_
Chain 'T':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qt_
Chain 'U':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qu_
Chain 'V':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qv_
Chain 'W':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qw_
Chain 'X':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
  - engineered (172)
Domains in SCOPe 2.08: d3a9qx_
Heterogens: CA, ACY, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3a9qA (A:)
akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
iseyvaqlrrvgkghgvwhfdqmllheggdaa