PDB entry 3a9q

View 3a9q on RCSB PDB site
Description: Crystal Structure Analysis of E173A variant of the soybean ferritin SFER4
Class: oxidoreductase
Keywords: 4-helix bundle, Chloroplast, Iron, Iron storage, Metal-binding, Oxidoreductase, Plastid, Transit peptide
Deposited on 2009-11-05, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.152
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qa_
  • Chain 'B':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qb_
  • Chain 'C':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qc_
  • Chain 'D':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qd_
  • Chain 'E':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qe_
  • Chain 'F':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qf_
  • Chain 'G':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qg_
  • Chain 'H':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qh_
  • Chain 'I':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qi_
  • Chain 'J':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qj_
  • Chain 'K':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qk_
  • Chain 'L':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9ql_
  • Chain 'M':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qm_
  • Chain 'N':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qn_
  • Chain 'O':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qo_
  • Chain 'P':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qp_
  • Chain 'Q':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qq_
  • Chain 'R':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qr_
  • Chain 'S':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qs_
  • Chain 'T':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qt_
  • Chain 'U':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qu_
  • Chain 'V':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qv_
  • Chain 'W':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qw_
  • Chain 'X':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q948P5
      • engineered (172)
    Domains in SCOPe 2.07: d3a9qx_
  • Heterogens: CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a9qA (A:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qA (A:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a9qB (B:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qB (B:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a9qC (C:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qC (C:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a9qD (D:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qD (D:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a9qE (E:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qE (E:)
    tvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdnvalrglakffkesse
    eerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhamelalslekltneklln
    lhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkghgvwhfdqmllhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a9qF (F:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qF (F:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3a9qG (G:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qG (G:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3a9qH (H:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qH (H:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3a9qI (I:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qI (I:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3a9qJ (J:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qJ (J:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3a9qK (K:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qK (K:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3a9qL (L:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qL (L:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3a9qM (M:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qM (M:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3a9qN (N:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qN (N:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3a9qO (O:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qO (O:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3a9qP (P:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qP (P:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3a9qQ (Q:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qQ (Q:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3a9qR (R:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qR (R:)
    gvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfd
    rdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalh
    amelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrv
    gkghgvwhfdqmllhe
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3a9qS (S:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qS (S:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3a9qT (T:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qT (T:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3a9qU (U:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qU (U:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3a9qV (V:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qV (V:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3a9qW (W:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qW (W:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3a9qX (X:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgaqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a9qX (X:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe