PDB entry 3a9m

View 3a9m on RCSB PDB site
Description: Crystal structure of a hemoglobin component V from Propsilocerus akamusi (pH9.0 coordinates)
Class: oxygen transport
Keywords: hemoglobin, insect, Diptera, Propsilocerus akamusi, midge larva, Heme, Oxygen transport, Transport
Deposited on 2009-10-30, released 2010-03-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin v
  Species: Tokunagayusurika akamusi [TaxId:28383]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M422 (0-151)
  Domains in SCOPe 2.05: d3a9ma_
• Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3a9mA (A:)
  afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
  anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
  ldsthgaawnkmmdnffyvfyecldgrcsqfs