PDB entry 3a9e

View 3a9e on RCSB PDB site
Description: Crystal structure of a mixed agonist-bound RAR-alpha and antagonist-bound RXR-alpha heterodimer ligand binding domains
Class: Transcription
Keywords: Transcription, Nucleus, Receptor, Transcription regulation, Structural Genomics, SPINE2-complexes, Structural Proteomics in Europe
Deposited on 2009-10-24, released 2010-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.204
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Mus musculus [TaxId:10090]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a9ea_
  • Chain 'B':
    Compound: retinoic acid receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RARA, NR1B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 13-mer (LXXLL motif) from Nuclear receptor coactivator 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 754, REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3a9eA (A:)
tssanedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvew
akriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagv
gaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyaslea
yckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqat

    Sequence, based on observed residues (ATOM records): (download) 
    >3a9eA (A:)
sanedmpvekileaelavepkspndpvtnicqaadkqlftlvewakriphfselplddqv
illragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmr
dmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfakl
llrlpalrsiglkclehlfffkligdtpidtflmemle

  • Chain 'B':
    No sequence available.

  • Chain 'I':
    No sequence available.