PDB entry 3a8o

View 3a8o on RCSB PDB site
Description: Crystal structure of Nitrile Hydratase complexed with Trimethylacetamide
Class: lyase
Keywords: nitrile hydratase, Fe, Iron, Lyase, Metal-binding, Oxidation
Deposited on 2009-10-07, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.192
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a8oa_
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a8ob_
  • Heterogens: FE, TAY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a8oA (A:)
    msvtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a8oA (A:)
    enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a8oB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa