PDB entry 3a8c

View 3a8c on RCSB PDB site
Description: Crystal Structure of Trypsin complexed with (E)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking with mixture of [(E)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid] and [(E)-2-(4-carbamimidoylbenzylideneaminooxy)-2-methylpropanoic acid])
Class: hydrolase
Keywords: In-Crystal Chemical Ligation, Disulfide bond, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen
Deposited on 2009-10-05, released 2010-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.154
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a8ca_
  • Heterogens: CA, O09, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3a8cA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn