PDB entry 3a8b

View 3a8b on RCSB PDB site
Description: Crystal Structure of Trypsin complexed with (E)-4-((4-bromophenylimino)methyl)benzimidamide
Class: hydrolase
Keywords: In-Crystal Chemical Ligation, Disulfide bond, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen
Deposited on 2009-10-05, released 2010-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.158
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cationic trypsin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.06: d3a8ba_
• Heterogens: CA, DMS, SO4, GOL, BR6, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3a8bA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn