PDB entry 3a7s

View 3a7s on RCSB PDB site
Description: Catalytic domain of UCH37
Class: hydrolase
Keywords: ubiquitin-proteasome pathway, Alternative splicing, Hydrolase, Polymorphism, Protease, Proteasome, Thiol protease, Ubl conjugation pathway
Deposited on 2009-10-04, released 2009-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: UCH37
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5K5
      • engineered (87)
    Domains in SCOPe 2.07: d3a7sa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a7sA (A:)
    mtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqp
    geepagsvvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqs
    fdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldg
    lregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a7sA (A:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp
    viekriqkysegeirfnlmaivsd