PDB entry 3a7r

View 3a7r on RCSB PDB site
Description: Crystal structure of E. coli lipoate-protein ligase A in complex with lipoyl-AMP.
Class: ligase
Keywords: ADENYLATE-FORMING ENZYME, lipoic acid, ATP-binding, Cytoplasm, Nucleotide-binding, Transferase, Lipoyl, LIGASE
Deposited on 2009-10-01, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:83333]
    Gene: lplA, yjjF, b4386, JW4349
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a7ra1, d3a7ra2
  • Heterogens: LAQ, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3a7rA (A:)
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
lyradmlqqeceallvdfpeqekelrelsawmagavr