PDB entry 3a7l

View 3a7l on RCSB PDB site
Description: Crystal structure of E. coli apoH-protein
Class: transport protein
Keywords: glycine cleavage system, lipoic acid, Lipoyl, TRANSPORT PROTEIN
Deposited on 2009-09-28, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.178
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine cleavage system H protein
    Species: Escherichia coli [TaxId:83333]
    Gene: GcvH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a7la_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3a7lA (A:)
snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
yeallede