PDB entry 3a7d

View 3a7d on RCSB PDB site
Description: Crystal Structures of rat Catechol-O-Methyltransferase complexed with new bi-substrate type inhibitor
Class: transferase
Keywords: Methyltransferase, NEUROTRANSMITTER DEGRADATION, ALTERNATIVE INITIATION, CATECHOLAMINE METABOLISM, S-ADENOSYL-L-METHIONINE, Cell membrane, Magnesium, Membrane, Metal-binding, Phosphoprotein, Signal-anchor, Transferase, Transmembrane
Deposited on 2009-09-26, released 2010-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.166
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3a7da_
  • Heterogens: MG, SO4, FBN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a7dA (A:)
    gsmgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireys
    pslvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilnga
    sqdlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpd
    flayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a7dA (A:)
    gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
    vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd
    lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
    yvrgsssfecthyssyleymkvvdglekaiyqgp