PDB entry 3a7a

View 3a7a on RCSB PDB site
Description: Crystal structure of E. coli lipoate-protein ligase A in complex with octyl-amp and apoH-protein
Class: ligase
Keywords: ADENIYLATE-FORMING ENZYME, ATP-binding, Nucleotide-binding, Transferase, Lipoyl, LIGASE
Deposited on 2009-09-20, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:83333]
    Gene: lplA, yjjF, b4386, JW4349
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a7aa1, d3a7aa2
  • Chain 'B':
    Compound: glycine cleavage system H protein
    Species: Escherichia coli [TaxId:83333]
    Gene: gcvH, b2904, JW2872
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a7ab_
  • Chain 'C':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:83333]
    Gene: lplA, yjjF, b4386, JW4349
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a7ac1, d3a7ac2
  • Chain 'D':
    Compound: glycine cleavage system H protein
    Species: Escherichia coli [TaxId:83333]
    Gene: gcvH, b2904, JW2872
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a7ad_
  • Heterogens: OCT, AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a7aA (A:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a7aB (B:)
    snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
    esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
    yeallede
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a7aB (B:)
    nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
    svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
    eallede
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a7aC (C:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a7aD (D:)
    snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
    esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
    yeallede
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a7aD (D:)
    nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
    svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
    eallede