PDB entry 3a77

View 3a77 on RCSB PDB site
Description: The crystal structure of phosphorylated IRF-3
Class: transcription
Keywords: phosphorylated protein, Activator, Antiviral defense, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on 2009-09-17, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a77a_
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a77b_
  • Chain 'C':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a77c_
  • Chain 'D':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a77d_
  • Heterogens: ACY, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a77A (A:)
    gamenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a77A (A:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvtlpgwpvtlpdpgmsltdr
    gvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpkdk
    eggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclral
    vemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a77B (B:)
    gamenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a77B (B:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsetlpgwpvtlpdpgmsl
    tdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevp
    kdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptcl
    ralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a77C (C:)
    gamenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a77C (C:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgstlpgwpvtlpdpgmslt
    drgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpk
    dkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclr
    alvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a77D (D:)
    gamenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a77D (D:)
    nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvglpgwpvtlpdpgmsltdrg
    vmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpkdke
    ggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclralv
    emarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpge