PDB entry 3a6r

View 3a6r on RCSB PDB site
Description: E13Q mutant of FMN-binding protein from Desulfovibrio vulgaris (Miyazaki F)
Class: electron transport
Keywords: Electron transport, Flavoprotein, FMN
Deposited on 2009-09-08, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.171
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered (12)
    Domains in SCOPe 2.07: d3a6ra_
  • Chain 'B':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered (12)
    Domains in SCOPe 2.07: d3a6rb_
  • Chain 'C':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered (12)
    Domains in SCOPe 2.07: d3a6rc_
  • Chain 'D':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered (12)
    Domains in SCOPe 2.07: d3a6rd_
  • Heterogens: FMN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a6rA (A:)
    mlpgtffevlknqgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a6rB (B:)
    mlpgtffevlknqgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a6rC (C:)
    mlpgtffevlknqgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a6rD (D:)
    mlpgtffevlknqgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl