PDB entry 3a6n

View 3a6n on RCSB PDB site
Description: The nucleosome containing a testis-specific histone variant, human H3T
Class: structural protein/DNA
Keywords: histone-fold, DNA-binding protein, Chromosomal protein, Citrullination, DNA-binding, Methylation, Nucleosome core, Nucleus, Phosphoprotein, Isopeptide bond, Antibiotic, Antimicrobial, STRUCTURAL PROTEIN-DNA COMPLEX
Deposited on 2009-09-04, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1t
    Species: Homo sapiens [TaxId:9606]
    Gene: H3T
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6na_
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6nb_
  • Chain 'C':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Gene: H2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6nc_
  • Chain 'D':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: H2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6nd_
  • Chain 'E':
    Compound: Histone H3.1t
    Species: Homo sapiens [TaxId:9606]
    Gene: H3T
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6ne_
  • Chain 'F':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6nf_
  • Chain 'G':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Gene: H2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6ng_
  • Chain 'H':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: H2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a6nh_
  • Chain 'I':
    Compound: 146-mer DNA
  • Chain 'J':
    Compound: 146-mer DNA
  • Heterogens: CL, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a6nA (A:)
    gshmartkqtarkstggkaprkqlatkvarksapatggvkkphryrpgtvalreirryqk
    stellirklpfqrlmreiaqdfktdlrfqssavmalqeacesylvglfedtnlcvihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nA (A:)
    phryrpgtvalreirryqkstellirklpfqrlmreiaqdfktdlrfqssavmalqeace
    sylvglfedtnlcvihakrvtimpkdiqlarrirger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a6nB (B:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nB (B:)
    lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
    tamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a6nC (C:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nC (C:)
    aktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a6nD (D:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nD (D:)
    rsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a6nE (E:)
    gshmartkqtarkstggkaprkqlatkvarksapatggvkkphryrpgtvalreirryqk
    stellirklpfqrlmreiaqdfktdlrfqssavmalqeacesylvglfedtnlcvihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nE (E:)
    phryrpgtvalreirryqkstellirklpfqrlmreiaqdfktdlrfqssavmalqeace
    sylvglfedtnlcvihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a6nF (F:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nF (F:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3a6nG (G:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nG (G:)
    ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3a6nH (H:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a6nH (H:)
    srkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.