PDB entry 3a6c

View 3a6c on RCSB PDB site
Description: Crystal Structure of HyHEL-10 Fv mutant LN92D complexed with hen egg white lysozyme
Class: immune system/hydrolase
Keywords: ANTIGEN-ANTIBODY COMPLEX, MUTANT, IMMUNE SYSTEM-HYDROLASE COMPLEX, Allergen, Antimicrobial, Bacteriolytic enzyme, Disulfide bond, Glycosidase
Deposited on 2009-08-28, released 2009-12-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IG VH, anti-lysozyme
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3A6C (0-113)
    Domains in SCOPe 2.01: d3a6ch_
  • Chain 'L':
    Compound: lysozyme binding Ig kappa chain V23-J2 region
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3A6C (0-106)
    Domains in SCOPe 2.01: d3a6cl_
  • Chain 'Y':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a6cH (H:)
    dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
    pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a6cL (L:)
    divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedfgmyfcqqsdswpytfgggtkleik
    

  • Chain 'Y':
    No sequence available.