PDB entry 3a68

View 3a68 on RCSB PDB site
Description: Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
Class: oxidoreductase
Keywords: 4-helix bundle, ferritin, iron storage, cage-like protein, plant, Chloroplast, Iron, Metal-binding, Oxidoreductase, Plastid, Transit peptide
Deposited on 2009-08-26, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.142
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68a_
  • Chain 'B':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68b_
  • Chain 'C':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68c_
  • Chain 'D':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68d_
  • Chain 'E':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68e_
  • Chain 'F':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68f_
  • Chain 'G':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68g_
  • Chain 'H':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68h_
  • Chain 'I':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68i_
  • Chain 'J':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68j_
  • Chain 'K':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68k_
  • Chain 'L':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68l_
  • Chain 'M':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68m_
  • Chain 'N':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68n_
  • Chain 'O':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68o_
  • Chain 'P':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68p_
  • Chain 'Q':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68q_
  • Chain 'R':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68r_
  • Chain 'S':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68s_
  • Chain 'T':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68t_
  • Chain 'U':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68u_
  • Chain 'V':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68v_
  • Chain 'W':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68w_
  • Chain 'X':
    Compound: Ferritin-4, chloroplastic
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a68x_
  • Heterogens: CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a68A (A:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68A (A:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a68B (B:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68B (B:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a68C (C:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68C (C:)
    vifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdr
    dnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalha
    melalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvg
    kghgvwhfdqmllheg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a68D (D:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68D (D:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a68E (E:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68E (E:)
    feevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdnval
    rglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhamelal
    slekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgkghgv
    whfdqmllhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a68F (F:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68F (F:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3a68G (G:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68G (G:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3a68H (H:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68H (H:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3a68I (I:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68I (I:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3a68J (J:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68J (J:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3a68K (K:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68K (K:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3a68L (L:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68L (L:)
    fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
    valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
    lalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgkg
    hgvwhfdqmllhe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3a68M (M:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68M (M:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3a68N (N:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68N (N:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3a68O (O:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68O (O:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3a68P (P:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68P (P:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3a68Q (Q:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68Q (Q:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3a68R (R:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68R (R:)
    gvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfd
    rdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalh
    amelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrv
    gkghgvwhfdqmllhe
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3a68S (S:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68S (S:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3a68T (T:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68T (T:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3a68U (U:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68U (U:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3a68V (V:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68V (V:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3a68W (W:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68W (W:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3a68X (X:)
    akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
    yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
    fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
    iseyvaqlrrvgkghgvwhfdqmllheggdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a68X (X:)
    ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
    nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
    elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
    ghgvwhfdqmllhe