SCOPe 2.08: Structural Classification of Proteins

PDB entry 3a68

View 3a68 on RCSB PDB site
Description: Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
Class: oxidoreductase
Keywords: 4-helix bundle, ferritin, iron storage, cage-like protein, plant, Chloroplast, Iron, Metal-binding, Oxidoreductase, Plastid, Transit peptide
Deposited on 2009-08-26, released 2009-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.142
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68a_
Chain 'B':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68b_
Chain 'C':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68c_
Chain 'D':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68d_
Chain 'E':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68e_
Chain 'F':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68f_
Chain 'G':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68g_
Chain 'H':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68h_
Chain 'I':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68i_
Chain 'J':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68j_
Chain 'K':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68k_
Chain 'L':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68l_
Chain 'M':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68m_
Chain 'N':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68n_
Chain 'O':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68o_
Chain 'P':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68p_
Chain 'Q':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68q_
Chain 'R':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68r_
Chain 'S':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68s_
Chain 'T':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68t_
Chain 'U':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68u_
Chain 'V':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68v_
Chain 'W':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68w_
Chain 'X':
Compound: Ferritin-4, chloroplastic
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
- Uniprot Q948P5
Domains in SCOPe 2.08: d3a68x_
Heterogens: CA, ACY, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3a68A (A:)
akgstnhraltgvifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvs
yvyhamfayfdrdnvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsd
fdhadkgdalhamelalslekltnekllnlhsvatkngdvqladfveteylgeqveaikr
iseyvaqlrrvgkghgvwhfdqmllheggdaa