PDB entry 3a5z

View 3a5z on RCSB PDB site
Description: Crystal structure of Escherichia coli GenX in complex with elongation factor P
Class: ligase
Keywords: aminoacyl-tRNA synthetase paralog, Translation, tRNA, Lysyl-tRNA synthetase, Elongation Factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Aminoacyl-tRNA synthetase, LIGASE
Deposited on 2009-08-17, released 2010-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative lysyl-tRNA synthetase
  Species: Escherichia coli [TaxId:562]
  Gene: genX, ECs5136
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGA2 (Start-327)
• Chain 'B':
  Compound: elongation factor P
  Species: Escherichia coli [TaxId:562]
  Gene: efp, ECs5128
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGD7
  Domains in SCOPe 2.08: d3a5zb1, d3a5zb2
• Chain 'C':
  Compound: Putative lysyl-tRNA synthetase
  Species: Escherichia coli [TaxId:562]
  Gene: genX, ECs5136
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGA2 (Start-327)
• Chain 'D':
  Compound: elongation factor P
  Species: Escherichia coli [TaxId:562]
  Gene: efp, ECs5128
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGD7
• Chain 'E':
  Compound: Putative lysyl-tRNA synthetase
  Species: Escherichia coli [TaxId:562]
  Gene: genX, ECs5136
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGA2 (Start-327)
• Chain 'F':
  Compound: elongation factor P
  Species: Escherichia coli [TaxId:562]
  Gene: efp, ECs5128
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGD7
• Chain 'G':
  Compound: Putative lysyl-tRNA synthetase
  Species: Escherichia coli [TaxId:562]
  Gene: genX, ECs5136
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGA2 (3-327)
• Chain 'H':
  Compound: elongation factor P
  Species: Escherichia coli [TaxId:562]
  Gene: efp, ECs5128
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SGD7
• Heterogens: KAA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3a5zB (B:)
  gshmatyysndfraglkimldgepyaveasefvkpgkgqafarvklrrlltgtrvektfk
  stdsaegadvvdmnltylyndgefwhfmnnetfeqlsadakaigdnakwlldqaecivtl
  wngqpisvtppnfveleivdtdpglkgdtagtggkpatlstgavvkvplfvqigevikvd
  trsgeyvsrvk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3a5zB (B:)
  tyysndfraglkimldgepyaveasefvkpgkgqafarvklrrlltgtrvektfkstdsa
  egadvvdmnltylyndgefwhfmnnetfeqlsadakaigdnakwlldqaecivtlwngqp
  isvtppnfveleiv
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.