PDB entry 3a5z

View 3a5z on RCSB PDB site
Description: Crystal structure of Escherichia coli GenX in complex with elongation factor P
Class: ligase
Keywords: aminoacyl-tRNA synthetase paralog, Translation, tRNA, Lysyl-tRNA synthetase, Elongation Factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Aminoacyl-tRNA synthetase, LIGASE
Deposited on 2009-08-17, released 2010-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lysyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: genX, ECs5136
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: elongation factor P
    Species: Escherichia coli [TaxId:562]
    Gene: efp, ECs5128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a5zb1, d3a5zb2
  • Chain 'C':
    Compound: Putative lysyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: genX, ECs5136
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: elongation factor P
    Species: Escherichia coli [TaxId:562]
    Gene: efp, ECs5128
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Putative lysyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: genX, ECs5136
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: elongation factor P
    Species: Escherichia coli [TaxId:562]
    Gene: efp, ECs5128
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Putative lysyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: genX, ECs5136
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: elongation factor P
    Species: Escherichia coli [TaxId:562]
    Gene: efp, ECs5128
    Database cross-references and differences (RAF-indexed):
  • Heterogens: KAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a5zB (B:)
    gshmatyysndfraglkimldgepyaveasefvkpgkgqafarvklrrlltgtrvektfk
    stdsaegadvvdmnltylyndgefwhfmnnetfeqlsadakaigdnakwlldqaecivtl
    wngqpisvtppnfveleivdtdpglkgdtagtggkpatlstgavvkvplfvqigevikvd
    trsgeyvsrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a5zB (B:)
    tyysndfraglkimldgepyaveasefvkpgkgqafarvklrrlltgtrvektfkstdsa
    egadvvdmnltylyndgefwhfmnnetfeqlsadakaigdnakwlldqaecivtlwngqp
    isvtppnfveleiv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.