PDB entry 3a5u

View 3a5u on RCSB PDB site
Description: Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex
Class: DNA binding protein
Keywords: DNA binding protein, DNA damage, DNA repair, DNA replication, DNA-binding
Deposited on 2009-08-12, released 2010-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3a5ua_
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3a5ub_
  • Chain 'C':
    Compound: DNA (31-mer)
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a5uA (A:)
    magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
    reaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka
    srsggggggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a5uA (A:)
    magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
    reaaenvaesltrgsrvivtgrlkqrsftregekrtvvevevdeigpslryatakvnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a5uB (B:)
    magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
    reaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka
    srsggggggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a5uB (B:)
    magdttitvvgnltadpelrftpsgaavanftvastprmgewkdgealflrcniwreaae
    nvaesltrgsrvivtgrlkqrsfetrekrtvvevevdeigpslryatakvnk
    

  • Chain 'C':
    No sequence available.