PDB entry 3a5q

View 3a5q on RCSB PDB site
Description: Benzalacetone synthase from Rheum palmatum
Class: transferase
Keywords: benzalacetone synthase, chalcone synthase, type III polyketide synthase, TRANSFERASE, Acyltransferase
Deposited on 2009-08-10, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzalacetone synthase
    Species: Rheum palmatum [TaxId:137221]
    Gene: bas
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a5qa1, d3a5qa2
  • Chain 'B':
    Compound: Benzalacetone synthase
    Species: Rheum palmatum [TaxId:137221]
    Gene: bas
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a5qb1, d3a5qb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a5qA (A:)
    gpgmateemkklatvmaigtanppncyyqadfpdfyfrvtnsdhlinlkqkfkrlcensr
    iekrylhvteeilkenpniaayeatslnvrhkmqvkgvaelgkeaalkaikewgqpkski
    thlivcclagvdmpgadyqltklldldpsvkrfmfyhlgcyaggtvlrlakdiaennkga
    rvlivcsemtttcfrgpsethldsmigqailgdgaaavivgadpdltverpifelvstaq
    tivpeshgaieghllesglsfhlyktvptlisnniktclsdaftplnisdwnslfwiahp
    ggpaildqvtakvglekeklkvtrqvlkdygnmssatvffimdemrkkslengqattgeg
    lewgvlfgfgpgitvetvvlrsvpvis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a5qA (A:)
    klatvmaigtanppncyyqadfpdfyfrvtnsdhlinlkqkfkrlcensriekrylhvte
    eilkenpniaayeatslnvrhkmqvkgvaelgkeaalkaikewgqpkskithlivcclag
    vdmpgadyqltklldldpsvkrfmfyhlgcyaggtvlrlakdiaennkgarvlivcsemt
    ttcfrgpsethldsmigqailgdgaaavivgadpdltverpifelvstaqtivpeshgai
    eghllesglsfhlyktvptlisnniktclsdaftplnisdwnslfwiahpggpaildqvt
    akvglekeklkvtrqvlkdygnmssatvffimdemrkkslengqattgeglewgvlfgfg
    pgitvetvvlrsvpvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a5qB (B:)
    gpgmateemkklatvmaigtanppncyyqadfpdfyfrvtnsdhlinlkqkfkrlcensr
    iekrylhvteeilkenpniaayeatslnvrhkmqvkgvaelgkeaalkaikewgqpkski
    thlivcclagvdmpgadyqltklldldpsvkrfmfyhlgcyaggtvlrlakdiaennkga
    rvlivcsemtttcfrgpsethldsmigqailgdgaaavivgadpdltverpifelvstaq
    tivpeshgaieghllesglsfhlyktvptlisnniktclsdaftplnisdwnslfwiahp
    ggpaildqvtakvglekeklkvtrqvlkdygnmssatvffimdemrkkslengqattgeg
    lewgvlfgfgpgitvetvvlrsvpvis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a5qB (B:)
    klatvmaigtanppncyyqadfpdfyfrvtnsdhlinlkqkfkrlcensriekrylhvte
    eilkenpniaayeatslnvrhkmqvkgvaelgkeaalkaikewgqpkskithlivcclag
    vdmpgadyqltklldldpsvkrfmfyhlgcyaggtvlrlakdiaennkgarvlivcsemt
    ttcfrgpsethldsmigqailgdgaaavivgadpdltverpifelvstaqtivpeshgai
    eghllesglsfhlyktvptlisnniktclsdaftplnisdwnslfwiahpggpaildqvt
    akvglekeklkvtrqvlkdygnmssatvffimdemrkkslengqattgeglewgvlfgfg
    pgitvetvvlrsvpv