PDB entry 3a5e

View 3a5e on RCSB PDB site
Description: Crystal structure of 5K RNase Sa
Class: hydrolase
Keywords: RNase Sa, 5K, Disulfide bond, Endonuclease, Hydrolase, Nuclease, Secreted
Deposited on 2009-08-06, released 2010-08-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.231
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: rnaSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered mutation (0)
      • engineered mutation (16)
      • engineered mutation (24)
      • engineered mutation (40)
      • engineered mutation (73)
    Domains in SCOPe 2.01: d3a5ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3a5eA (A:)
kvsgtvclsalppeatktlnliaskgpfpysqdgvvfqnrksvlptqsygyyheytvitp
gartrgtrriitgkatqedyytgdhyatfslidqtc