PDB entry 3a5b

View 3a5b on RCSB PDB site
Description: Crystal structure of a hemoglobin component V from Propsilocerus akamusi (pH6.5 coordinates)
Class: oxygen transport
Keywords: hemoglobin, insect, Diptera, Propsilocerus akamusi, midge larva, Heme, Oxygen transport, Transport
Deposited on 2009-08-05, released 2010-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin v
    Species: Tokunagayusurika akamusi [TaxId:28383]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a5ba_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a5bA (A:)
    afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
    anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
    ldsthgaawnkmmdnffyvfyecldgrcsqfs