PDB entry 3a4p

View 3a4p on RCSB PDB site
Description: human c-MET kinase domain complexed with 6-benzyloxyquinoline inhibitor
Class: Transferase
Keywords: C-MET, TYROSINE-PROTEIN KINASE, HEPATOCYTE GROWTH FACTOR RECEPTOR, Transferase
Deposited on 2009-07-13, released 2010-02-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-318)
      • engineered (152)
    Domains in SCOPe 2.04: d3a4pa_
  • Heterogens: CL, IPA, DFQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a4pA (A:)
    gplhmgsntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldnd
    gkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymk
    hgdlrnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkva
    dfglardmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrga
    ppypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaif
    stfigehyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a4pA (A:)
    vqavqhvvigpsslivhfnevigrghfgcvyhgtlldkkihcavkslnritdigevsqfl
    tegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdligfg
    lqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydkaklpvkwmalesl
    qtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyev
    mlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk