PDB entry 3a4j

View 3a4j on RCSB PDB site
Description: arPTE (K185R/D208G/N265D/T274N)
Class: hydrolase
Keywords: phosphotriesterase, HYDROLASE
Deposited on 2009-07-07, released 2010-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.129
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (Start-328)
      • engineered (59)
      • engineered (152)
      • engineered (175)
      • engineered (232)
      • engineered (241)
    Domains in SCOPe 2.02: d3a4ja_
  • Heterogens: CO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a4jA (A:)
    tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara
    agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
    eiqhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsasqrggeqq
    aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalf
    gnrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
    ipflrekgvppetlagvtvanparflspt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a4jA (A:)
    gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharaa
    gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre
    iqhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsasqrggeqqa
    aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalfg
    nrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi
    pflrekgvppetlagvtvanparflspt