PDB entry 3a4g

View 3a4g on RCSB PDB site
Description: Structure of cytochrome P450 vdh from Pseudonocardia autotrophica (trigonal crystal form)
Class: oxidoreductase
Keywords: Cytochrome P450, vitamin D3 hydroxylase, hemoprotein, Monooxygenase, OXIDOREDUCTASE
Deposited on 2009-07-07, released 2010-07-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D hydroxylase
    Species: Pseudonocardia autotrophica [TaxId:2074]
    Gene: vdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a4ga_
  • Heterogens: HEM, PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a4gA (A:)
    maltttgteqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvd
    prlskdwrhtlpedqradmpatptpmmilmdppdhtrlrklvgrsftvrrmneleprite
    iadgllaglptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddk
    naamgklhgylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghet
    tvnligngvlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgv
    tipagemvmlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrva
    igrlfadrpelalavgldelvyrestlvrglsrmpvtmgprsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a4gA (A:)
    eqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdprlskdwr
    htlpedqradmpatptpmmilmdppdhtrlrklvgrsftvrrmnelepriteiadgllag
    lptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddknaamgklh
    gylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghettvnligng
    vlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvtipagemv
    mlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvaigrlfadr
    pelalavgldelvyrestlvrglsrmpvtmgprsa