PDB entry 3a4f

View 3a4f on RCSB PDB site
Description: Crystal Structure of Human Transthyretin (E54K)
Class: transport protein
Keywords: BETA BARREL, Amyloid, Amyloidosis, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Neuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A, TRANSPORT PROTEIN, THYROXINE
Deposited on 2009-07-06, released 2009-12-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.174
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • see remark 999 (53)
    Domains in SCOPe 2.03: d3a4fa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • see remark 999 (53)
    Domains in SCOPe 2.03: d3a4fb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a4fA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgklhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a4fA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgklhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a4fB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgklhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a4fB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgklhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn