PDB entry 3a4c

View 3a4c on RCSB PDB site
Description: Crystal structure of cdt1 C terminal domain
Deposited on 2009-07-06, released 2009-10-13
The last revision was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA replication factor Cdt1
    Species: Mus musculus [TaxId:10090]
    Gene: Cdt1, Ris2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3a4cA (A:)
rcpeqelrlqrlerlpelarvlrnvfvserkpaltmevvcarmvdscqtalspgemekhl
vllaellpdwlslhrirtdtyvkldkavdlagltarlahhvhaegl