PDB entry 3a3v

View 3a3v on RCSB PDB site
Description: Crystal structure of reducing-end-xylose releasing exo-oligoxylanase Y198F mutant
Class: hydrolase
Keywords: HYDROLASE, Xylan degradation
Deposited on 2009-06-22, released 2009-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase Y
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH2105
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KB30
      • engineered (197)
    Domains in SCOPe 2.08: d3a3va_
  • Heterogens: NI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a3vA (A:)
    mekttegafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgyll
    dtgnldvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtk
    nswgpapdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnr
    dnklikfipevefsdpsfhlphfyelfslwaneedrvfwkeaaeasreylkiachpetgl
    apeyayydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkep
    edyrrykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryy
    dnclylfamlalsgnfkiwfpegqeeehlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a3vA (A:)
    egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
    dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
    apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
    kfipevefsdpsfhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
    yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
    ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
    lfamlalsgnfkiwfp