PDB entry 3a3q

View 3a3q on RCSB PDB site
Description: Structure of N59D HEN EGG-WHITE LYSOZYME in complex with (GlcNAc)3
Class: hydrolase
Keywords: Alpha and beta, Allergen, Antimicrobial, Bacteriolytic enzyme, Disulfide bond, Glycosidase, Hydrolase
Deposited on 2009-06-16, released 2009-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered (58)
    Domains in SCOPe 2.08: d3a3qa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a3qA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqids
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl