PDB entry 3a3k

View 3a3k on RCSB PDB site
Description: Reversibly bound chloride in the atrial natriuretic peptide receptor hormone-binding domain
Class: lyase
Keywords: NATRIURETIC PEPTIDE RECEPTOR, GUANYLYL-CYCLASE-COUPLED RECEPTOR, chloride binding motif, SIGNAL TRANSDUCTION, SIGNALING PROTEIN, MEMBRANE PROTEIN, cGMP biosynthesis, Chloride, Disulfide bond, Glycoprotein, GTP-binding, Lyase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transmembrane
Deposited on 2009-06-14, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Atrial natriuretic peptide receptor A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NPR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a3ka_
  • Chain 'B':
    Compound: Atrial natriuretic peptide receptor A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NPR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a3kb_
  • Heterogens: NAG, SO4, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a3kA (A:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgfdnedpacnqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a3kA (A:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a3kB (B:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgfdnedpacnqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a3kB (B:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslkpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlklladkkfn
    ftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgvtgylki
    drngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdvpkcgfd
    nedpacnqd