PDB entry 3a3h

View 3a3h on RCSB PDB site
Description: cellotriose complex of the endoglucanase cel5a from bacillus agaradherans at 1.6 a resolution
Class: hydrolase
Keywords: hydrolase, cellulose degradation, endoglucanase, glycoside hydrolase family 5
Deposited on 1998-02-01, released 1999-03-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.148
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Bacillus agaradhaerens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3a3ha_
  • Heterogens: CTR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3a3hA (A:)
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires