PDB entry 3a38

View 3a38 on RCSB PDB site
Description: Crystal structure of high-potential iron-sulfur protein from Thermochromatium tepidum at 0.7 angstrom resolution
Class: electron transport
Keywords: IRON-SULFUR CLUSTER, ELECTRON TRANSPORT, Iron, Iron-sulfur, Metal-binding, Transport
Deposited on 2009-06-10, released 2010-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 0.7 Å
R-factor: 0.067
AEROSPACI score: 1.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron-sulfur protein
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a38a_
  • Heterogens: SF4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3a38A (A:)
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag