PDB entry 3a2m

View 3a2m on RCSB PDB site
Description: CRYSTAL STRUCTURE OF DBJA (WILD TYPE Type I)
Class: hydrolase
Keywords: A/B-HYDROLASE, Hydrolase
Deposited on 2009-05-23, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.156
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2ma_
  • Chain 'B':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2mb_
  • Heterogens: CL, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2mA (A:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2mA (A:)
    eirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfg
    qsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafme
    firpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivr
    klgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllf
    tgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a2mB (B:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2mB (B:)
    eieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdlig
    fgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglaf
    mefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggi
    vrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkl
    lftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavr