PDB entry 3a2j

View 3a2j on RCSB PDB site
Description: Crystal structure of the human vitamin D receptor (H305F/H397F) ligand binding domain complexed with TEI-9647
Class: hormone receptor, transcription
Keywords: hormone/growth factor receptor, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Zinc-finger, Activator, Disease mutation, Receptor, HORMONE RECEPTOR
Deposited on 2009-05-20, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11473 (4-End)
    • Uniprot P11473 (51-End)
      • engineered mutation (140)
      • engineered mutation (232)
    Domains in SCOPe 2.07: d3a2ja_
  • Heterogens: TEJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2jA (A:)
    gshmdslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsql
    smlphladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddm
    swtcgnqdykyrvsdvtkagfslelieplikfqvglkklnlheeehvllmaicivspdrp
    gvqdaalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneefskqyrcl
    sfqpecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2jA (A:)
    dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkagfslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneefskqyrclsfqpec
    smkltplvlevfg