PDB entry 3a2h

View 3a2h on RCSB PDB site
Description: Crystal structure of the rat vitamin D receptor ligand binding domain complexed with TEI-9647 and a synthetic peptide containing the NR2 box of DRIP 205
Class: hormone receptor, transcription
Keywords: hormone/growth factor receptor, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Zinc-finger, Activator, Receptor, HORMONE RECEPTOR
Deposited on 2009-05-20, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2ha_
  • Chain 'B':
    Compound: Mediator of RNA polymerase II transcription subunit 1 peptide
    Species: homo sapiens, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TEJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2hA (A:)
    gshmlkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldls
    plsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmd
    dmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspd
    rpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyr
    slsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2hA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrplsmlphladlvsysiqkvigfak
    mipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskaght
    lelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqty
    ircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgne
    

  • Chain 'B':
    No sequence available.