PDB entry 3a2g

View 3a2g on RCSB PDB site
Description: Crystal Structure of K102C-Myoglobin conjugated with Fluorescein
Class: oxygen transport
Keywords: Oxygen Storage/Transport, OXYGEN TRANSPORT, Heme, Iron, Metal-binding, Muscle protein, Transport
Deposited on 2009-05-20, released 2010-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.179
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered (102)
    Domains in SCOPe 2.08: d3a2ga_
  • Heterogens: HEM, SO4, GOL, LCY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a2gA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipicylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg