PDB entry 3a2e

View 3a2e on RCSB PDB site
Description: Crystal structure of ginkbilobin-2, the novel antifungal protein from Ginkgo biloba seeds
Deposited on 2009-05-13, released 2009-06-02
The last revision was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ginkbilobin-2
    Species: Ginkgo biloba [TaxId:3311]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ginkbilobin-2
    Species: Ginkgo biloba [TaxId:3311]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ginkbilobin-2
    Species: Ginkgo biloba [TaxId:3311]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ginkbilobin-2
    Species: Ginkgo biloba [TaxId:3311]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3a2eA (A:)
antafvssacntqkipsgspfnrnlramladlrqntafsgydyktsragsggaptaygra
tckqsisqsdctaclsnlvnrifsicnnaigarvqlvdcfiqyeqrsf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3a2eB (B:)
antafvssacntqkipsgspfnrnlramladlrqntafsgydyktsragsggaptaygra
tckqsisqsdctaclsnlvnrifsicnnaigarvqlvdcfiqyeqrsf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3a2eC (C:)
antafvssacntqkipsgspfnrnlramladlrqntafsgydyktsragsggaptaygra
tckqsisqsdctaclsnlvnrifsicnnaigarvqlvdcfiqyeqrsf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3a2eD (D:)
antafvssacntqkipsgspfnrnlramladlrqntafsgydyktsragsggaptaygra
tckqsisqsdctaclsnlvnrifsicnnaigarvqlvdcfiqyeqrsf