PDB entry 3a2c

View 3a2c on RCSB PDB site
Description: Crystal structure of a pyrazolopyrimidine inhibitor complex bound to MAPKAP Kinase-2 (MK2)
Class: Transferase
Keywords: Gly-rich loop formed, aipha-helix, Alternative splicing, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2009-05-12, released 2010-05-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.288
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2ca_
  • Chain 'B':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2cb_
  • Chain 'C':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2cc_
  • Chain 'D':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2cd_
  • Chain 'E':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2ce_
  • Chain 'F':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2cf_
  • Chain 'G':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2cg_
  • Chain 'H':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2ch_
  • Chain 'I':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2ci_
  • Chain 'J':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2cj_
  • Chain 'K':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2ck_
  • Chain 'L':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a2cl_
  • Heterogens: PDY, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2cA (A:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cA (A:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsvapevlydks
    cdmwslgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllktep
    tqrmtitefmnhpwimqstkvpqtplhtsrvlke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a2cB (B:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cB (B:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsvapevlydks
    cdmwslgvimyillcgyppfysnspgmktrirmgqyefpnpewsevseevkmlirnllkt
    eptqrmtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a2cC (C:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cC (C:)
    vksglqikknaiiddykvtsvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelh
    wrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimk
    sigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlydksc
    dmwslgvimyillcgyppfysnspgmktrirmgqyefpnpewsevseevkmlirnllkte
    ptqrmtitefmnhpwimqstkvpqtplhtsrvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a2cD (D:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cD (D:)
    vksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsvapevlekydk
    scdmwslgvimyillcgyppfysnhpgmktrirmgqyefpnpewsevseevkmlirnllk
    teptqrmtitefmnhpwimqstkvpqtplhtsrvlke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a2cE (E:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cE (E:)
    vksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlydks
    cdmwslgvimyillcgyppfysnspgmktrirmgqyefpnpewsevseevkmlirnllkt
    eptqrmtitefmnhpwimqstkvpqtplhtsrvlke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a2cF (F:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cF (F:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlgpe
    kydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseev
    kmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3a2cG (G:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cG (G:)
    vksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlydks
    cdmwslgvimyillcgyppfysnpgmktrirmgqyefpnpewsevseevkmlirnllkte
    ptqrmtitefmnhpwimqstkvpqtplhtsrvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3a2cH (H:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cH (H:)
    hvksglqikknaiiddykvtsvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlydks
    cdmwslgvimyillcgyppfysnspgmktrirmgqyefpnpewsevseevkmlirnllkt
    eptqrmtitefmnhpwimqstkvpqtplhtsrvlk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3a2cI (I:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cI (I:)
    vksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlydks
    cdmwslgvimyillcgyppfysnspgmktrirmgqyefpnpewsevseevkmlirnllkt
    eptqrmtitefmnhpwimqstkvpqtplhtsrvlk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3a2cJ (J:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cJ (J:)
    vksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlydks
    cdmwslgvimyillcgyppfysnspgmktrirmgqyefpnpewsevseevkmlirnllkt
    eptqrmtitefmnhpwimqstkvpqtplhtsrvlk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3a2cK (K:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cK (K:)
    vksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsvapevlydksc
    dmwslgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllktept
    qrmtitefmnhpwimqstkvpqtplhtsrvlke
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3a2cL (L:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2cL (L:)
    vksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevel
    hwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseim
    ksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsyvapevlydks
    cdmwslgvimyillcgyppfysnspgmktrirmgqyefpnpewsevseevkmlirnllkt
    eptqrmtitefmnhpwimqstkvpqtplhtsrvlke