PDB entry 3a2b

View 3a2b on RCSB PDB site
Description: Crystal Structure of Serine Palmitoyltransferase from Sphingobacterium multivorum with substrate L-serine
Class: transferase
Keywords: vitamin B6-dependent enzyme Fold type I, Acyltransferase, Pyridoxal phosphate, Transferase
Deposited on 2009-05-09, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine palmitoyltransferase
    Species: Sphingobacterium multivorum [TaxId:28454]
    Gene: spt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2ba_
  • Heterogens: SER, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2bA (A:)
    skgklgekisqfkiveelkakglyayfrpiqskqdtevkidgrrvlmfgsnsylglttdt
    riikaaqdalekygtgcagsrflngtldihveleeklsayvgkeaailfstgfqsnlgpl
    sclmgrndyillderdhasiidgsrlsfskvikyghnnmedlraklsrlpedsaklictd
    gifsmegdivnlpeltsianefdaavmvddahslgvighkgagtashfglnddvdlimgt
    fskslaslggfvagdadvidflkhnarsvmfsasmtpasvastlkaleiiqnepehiekl
    wkntdyakaqlldhgfdlgatespilpifirsnektfwvtkmlqddgvfvnpvvspavpa
    eeslirfslmathtydqideaiekmvkvfkqaevetli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2bA (A:)
    skgklgekisqfkiveelkakglyayfrpiqskqdtevkidgrrvlmfgsnsylglttdt
    riikaaqdalekygtgcagsrflngtldihveleeklsayvgkeaailfstgfqsnlgpl
    sclmgrndyillderdhasiidgsrlsfskvikyghnnmedlraklsrlpedsaklictd
    gifsmegdivnlpeltsianefdaavmvddahslgvighkgagtashfglnddvdlimgt
    fskslaslggfvagdadvidflkhnarsvmfsasmtpasvastlkaleiiqnepehiekl
    wkntdyakaqlldhgfdlgatespilpifirsnektfwvtkmlqddgvfvnpvvspavpa
    eeslirfslmathtydqideaiekmvkvfkqa