PDB entry 3a28

View 3a28 on RCSB PDB site
Description: Crystal structure of L-2,3-butanediol dehydrogenase
Class: Oxidoreductase
Keywords: chiral substrate recognition, Oxidoreductase
Deposited on 2009-05-02, released 2009-12-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28a_
  • Chain 'B':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28b_
  • Chain 'C':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28c_
  • Chain 'D':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28d_
  • Chain 'E':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28e_
  • Chain 'F':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28f_
  • Chain 'G':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28g_
  • Chain 'H':
    Compound: L-2.3-butanediol dehydrogenase
    Species: Brevibacterium saccharolyticum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3a28h_
  • Heterogens: NAD, BME, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a28A (A:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28A (A:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a28B (B:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28B (B:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a28C (C:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28C (C:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a28D (D:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28D (D:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a28E (E:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28E (E:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a28F (F:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28F (F:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3a28G (G:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28G (G:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3a28H (H:)
    mskvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgl
    dvtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgi
    qaasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvn
    ayapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasen
    snyvtgqvmlvdggmlyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a28H (H:)
    skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
    vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
    aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
    yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
    nyvtgqvmlvdggmlyn