PDB entry 3a13

View 3a13 on RCSB PDB site
Description: Crystal structure of Type III Rubisco SP4 mutant complexed with 2-CABP and activated with Ca
Class: lyase
Keywords: ribulose-1, 2-bisphosphate carboxylase/oxygenase, Rubisco, LYASE, Carbon dioxide fixation, Magnesium, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2009-03-25, released 2010-04-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13a1, d3a13a2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13b1, d3a13b2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13c1, d3a13c2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13d1, d3a13d2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13e1, d3a13e2
  • Chain 'F':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13f1, d3a13f2
  • Chain 'G':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13g1, d3a13g2
  • Chain 'H':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13h1, d3a13h2
  • Chain 'I':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13i1, d3a13i2
  • Chain 'J':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93627 (Start-443)
      • engineered (325-329)
    Domains in SCOPe 2.03: d3a13j1, d3a13j2
  • Heterogens: MG, CAP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a13A (A:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13A (A:)
    ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
    dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
    peklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadym
    kddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlg
    lkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrli
    gidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptssg
    glhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakth
    kelaralekwghvtpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a13B (B:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13B (B:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a13C (C:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13C (C:)
    tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
    wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
    yfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngad
    ymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevlad
    lglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyr
    ligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafpts
    sgglhpgniqpviealgtdivlqlgggtlghdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a13D (D:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13D (D:)
    fdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgwttpwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a13E (E:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13E (E:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtkleerditiqnarilreshykpdendvfhleqkfysikaafptssgglhp
    gniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkela
    ralekwghvtpv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a13F (F:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13F (F:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3a13G (G:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13G (G:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3a13H (H:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13H (H:)
    tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
    wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
    yfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngad
    ymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevlad
    lglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyr
    ligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafpts
    sgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyak
    thkelaralekwghvtpv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3a13I (I:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13I (I:)
    fdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgwttpwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3a13J (J:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a13J (J:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagkleerditiqnarilreshykpdendvfhleqkfysikaafptssggl
    hpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthke
    laralekwghvtpv