PDB entry 3a10

View 3a10 on RCSB PDB site
Description: Crystal structure of response regulator protein TrrA (TM1360) from Thermotoga maritima in complex with Mg(2+)-BeF (SeMet, L89M)
Class: signaling protein
Keywords: phosphoacceptor, SIGNALING PROTEIN
Deposited on 2009-03-25, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.203
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X181 (0-115)
      • engineered (88)
    Domains in SCOPe 2.08: d3a10a_
  • Heterogens: MG, BEF, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a10A (A:)
    mkrilvvddepnirellkeelqeegyeidtaengeealkkffsgnydlvildiempgisg
    levageirkkkkdakiilltayshyrsdmsswaadeyvvksfnfdelkekvkklls