PDB entry 3a0x

View 3a0x on RCSB PDB site
Description: Catalytic domain of histidine kinase ThkA (TM1359) (nucleotide free form 1: ammomium phosphate, monoclinic)
Deposited on 2009-03-25, released 2009-10-20
The last revision was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X180 (1-End)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3a0xA (A:)
meftefnlnelirevyvlfeekirkmnidfcfetdnedlrveadrtrikqvlinlvqnai
eatgengkikitsedmytkvrvsvwnsgppipeelkekifspffttktqgtglglsicrk
iiedehggkiwtenrengvvfifeipktpekr

    Sequence, based on observed residues (ATOM records):
    >3a0xA (A:)
meftefnlnelirevyvlfeekirkmnidfcfetdnedlrveadrtrikqvlinlvqnai
eatgengkikitsedmytkvrvsvwnsgppipeelkekifspffttktqgtglglsicrk
iiedehggkiwtenrengvvfifeipktp