PDB entry 3a0v

View 3a0v on RCSB PDB site
Description: pas domain of histidine kinase thka (tm1359) (semet, f486m/f489m)
Deposited on 2009-03-24, released 2009-10-20
The last revision was dated 2021-11-10, with a file datestamp of 2021-11-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.231
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X180 (1-95)
      • expression tag (0)
      • engineered mutation (63)
      • engineered mutation (66)
  • Heterogens: EOH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3a0vA (A:)
metaiitlskdgritewnkkaeqlfglkkenvlgrrlkdlpdfeeigsvaesvfenkepv
flnmykmgeryfnirfspfrnaktqllegviitidd